PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca24602.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 365aa    MW: 39612 Da    PI: 6.7159
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca24602.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.77e-421892881100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la++++
  Dca24602.1 189 PCAACKILRRRCADKCVLAPYFPPSEPLKFTIAHRVFGASNIIKFLQELPEAQRADAVSSMVYEANARLRDPVYGCAGAICQLQNQVSELQAQLAKARA 287
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  Dca24602.1 288 E 288
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd092723.10E-3853145No hitNo description
PROSITE profilePS5089125.945188289IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-42189286IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MRPDLAYSVH TLSQYMHAPR EYHWAAALRV VRYLKGAPGQ GILLRSDAPL SSGWCGSDWA  60
ACPDTRRSLT GWLVFLGTSP ASPVPISCNS QSALHIAHSP VFHERTKHIE IDCHFVRDAI  120
KEGLIAPSYV NTSTQLADAL TKSLGVAQFT LLISKMGELS MDNNEAISAS SPAPQSTTAV  180
AASAVVVSPC AACKILRRRC ADKCVLAPYF PPSEPLKFTI AHRVFGASNI IKFLQELPEA  240
QRADAVSSMV YEANARLRDP VYGCAGAICQ LQNQVSELQA QLAKARAEVV SMKCQQANLL  300
ALICMEVAHQ QRPTVSDDSP ESQSPERPDN FPSNDACFIN DDNLGSIWSH FGPDVLSTEF  360
SLTSN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-60LOB domain-containing protein 1